PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN48069.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YA
Protein Properties Length: 206aa    MW: 23028.2 Da    PI: 7.2918
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN48069.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA105.25.5e-33111167158
   CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                 +ep++VNaKQy++Il+RRq+Rak+e+e+k+ +++rkpylheSRhkhAlrRpRg+gGrF
  KHN48069.1 111 EEPVFVNAKQYHGILRRRQSRAKAESENKV-IRNRKPYLHESRHKHALRRPRGCGGRF 167
                 69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.6E-37109170IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.788110170IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.0E-28112167IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.3E-24113135IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860115135IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.3E-24144167IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MTSAHDLTDN EDDGQQQSES QIQSPSANGI SDPDISTQNV NVQYATPGQL GTGHAMVPPV  60
YPYPDPYYRS IFAPYDTQPY PPQAYSGQPM VHLQLMGIQQ AGVPLPTDAV EEPVFVNAKQ  120
YHGILRRRQS RAKAESENKV IRNRKPYLHE SRHKHALRRP RGCGGRFLNS KKDENQHDDV  180
TSADKSQSNI NLNSNKNDQT SSDRTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-22110177168NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1151160RHKHALRRPR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0894150.0BT089415.1 Soybean clone JCVI-FLGm-1L22 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001235566.11e-151uncharacterized protein LOC100499754
SwissprotQ84JP12e-73NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLA0A0B2SU561e-153A0A0B2SU56_GLYSO; Nuclear transcription factor Y subunit A-7
TrEMBLI1KSM71e-153I1KSM7_SOYBN; Uncharacterized protein
STRINGGLYMA08G13090.11e-152(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53793355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.24e-61nuclear factor Y, subunit A7
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]